Recombinant Mouse IL24 , CYT-Q925S4

Background Information

IL-24, also known as Interleukin-24, is a critical immune regulatory cytokine that plays a pivotal role in modulating immune responses. This protein is involved in regulating various aspects of the immune system, including inflammatory and anti-tumor responses. IL-24 is renowned for its multifunctional properties, such as inducing apoptosis (programmed cell death) in cancer cells while sparing normal cells, making it a promising candidate for cancer therapeutics. Additionally, IL-24 possesses anti-inflammatory properties, contributing to the regulation of immune cell activity.

Description

IL-24 Protein is a crucial immune regulatory cytokine pivotal for modulating immune responses. This Animal-Free IL-24 Protein, Mouse (His) is the recombinant mouse-derived IL-24 protein, produced in *E. coli* without any animal-derived components, and features a C-terminal His-tag. This product is for cell culture use only.

Full Name

Recombinant Mouse Interleukin-24 (IL-24) Protein (Animal-Free, E. coli-derived, C-His tag)

Specifications

Source: Escherichia coli

Species: Mouse.

Amino Acid Sequence (Q27-L181): MQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVL

RNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL

Accession #: A0A0R4J1N5 (Q27-L181)

Gene ID: 93672 [NCBI]

Predicted Molecular Weight: 18.9 kDa.

Observed Molecular Weight: Approximately 17 kDa, as determined by SDS-PAGE under reducing conditions.

Protein Length: Full length of the mature protein.

Tag: C-terminal 6xHis tag.

Protein Structure:N-term- IL-24 (Q27-L181)-6xHis-C-term

Purity: >95% as determined by reducing SDS-PAGE.

Form: Sterile lyophilized powder.

Formulation: Lyophilized from a 0.22 µm filtered solution containing 1X PBS, pH 7.4.

Endotoxin Level: <0.1 EU per 1 ¦Ìg of protein, determined by the LAL method.

Biological Activity: Measured by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED₅₀ for this effect is <0.3 ng/mL.

Storage & Stability

Lyophilized Powder: Store at -20¡ãC for up to 2 years from the date of receipt.

Reconstituted Solution: After reconstitution, it is stable at 4¡ãC for 1 week or at -20¡ãC for longer periods when a carrier protein is added (see Reconstitution).

Long-term Storage: For extended storage, it is recommended to aliquot the reconstituted solution and freeze at -20¡ãC or -80¡ãC.

Shipping

Shipped at room temperature. Transit times may vary for destinations outside the continental US.

Aliases

Interleukin-24; IL-4-induced secreted protein; IL-24; Melanoma differentiation-associated gene 7 protein (MDA-7); Th2-specific cytokine FISP; C49A; Mda-7; ST16

Reconstitution

It is recommended to reconstitute the lyophilized protein to a concentration of 100-200 ¦Ìg/mL in sterile ddH₂O. For long-term storage of the reconstituted solution, it is recommended to add a carrier protein (e.g., 0.1% BSA, 5% HSA, 10% FBS, or 5% Trehalose).

Intended Use

For research use only, specifically for cell culture applications. Not for diagnostic or therapeutic use.

Order Information